PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12112A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 270aa    MW: 30027.6 Da    PI: 6.4099
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12112AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd+ lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_12112A 14 KGPWTPEEDKVLVAHIQRFGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                               79******************************99************97 PP

2Myb_DNA-binding53.94.3e-1767112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++++eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Oropetium_20150105_12112A  67 RGNFSKEEEETIIQLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                                89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.728961IPR017930Myb domain
SuperFamilySSF466893.67E-3110108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002499.4E-151461IPR001005SANT/Myb domain
CDDcd001674.25E-101661No hitNo description
PROSITE profilePS5129426.01262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-2765116IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002495.8E-1667112IPR001005SANT/Myb domain
CDDcd001672.36E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKVLVAHIQ RFGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SKEEEETIIQ LHELLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEHPA  120
SNSKQDRAPP AGASNSNKKK QKPAAATKRG GARKVPADDQ PEVAPATTSA PPVSSPERSV  180
SSSATESSTM TTERGNKEEE SFTSSEEFQI DESFWSETLS MPLESFDIPM DEEHTAEAFG  240
PSSSGGADDM DFWLRVFMET DEVQELPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0939541e-138FP093954.1 Phyllostachys edulis cDNA clone: bphyem107b06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448188.11e-117hypothetical protein SORBIDRAFT_06g022660
SwissprotQ7XBH41e-111MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLC5YCC81e-117C5YCC8_SORBI; Putative uncharacterized protein Sb06g022660
STRINGSb06g022660.11e-116(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-78myb domain protein 14